Pay in installments of $34.38 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 22 - Aug 27
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human INOS, His tagProduct Specification Species Human Synonyms Hepatocyte NOS (HEP NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl cysteine S nitrosylase NOS2, NOS2A Accession P35228 Amino Acid Sequence Protein sequence (P35228, Ala2 Cys200, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Hepatocyte NOS (HEP-NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2A |
| Accession | P35228 |
| Amino Acid Sequence | Protein sequence (P35228, Ala2-Cys200, with C-10*His) ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 24.2 kDa Observed MW: 43-55 kDa |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Nitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine. NO is an important cellular signaling molecule. It helps modulate vascular tone, insulin secretion, airway tone, and peristalsis, and is involved in angiogenesis and neural development. Nitric oxide is mediated in mammals by the calcium-calmodulin controlled isoenzymes eNOS (endothelial NOS) and nNOS (neuronal NOS). Nitric oxide synthase, inducible (iNOS) is an enzyme which is encoded by the NOS2 gene in humans and mice. INOS involved in immune response, binds calmodulin at physiologically relevant concentrations, and produces NO as an immune defense mechanism. In mice, the function of Nos2 in immunity against a number of viruses, bacteria, fungi, and parasites has been well characterized. Nos2 is important for protective immunity against CMV.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy